Abnova™ Human TMSB4X Full-length ORF (NP_066932, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-116	10 ug
89-965-117	25 ug

Catalog No. 89-965-116 Supplier Abnova™ Supplier No. H00007114P02S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq]

Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Specifications

• Accession Number: NP_066932
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7114
• Molecular Weight (g/mol): 30.58kDa
• Name: TMSB4X (Human) Recombinant Protein (P02)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FX/PTMB4/TB4X/TMSB4
• Common Name: TMSB4X
• Gene Symbol: TMSB4X
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid