Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human TNFRSF9 Partial ORF (AAH06196, 87 a.a. - 186 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89965244 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 ug
25 ug
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-965-244 10 ug
89-965-245 25 ug
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-965-244 Supplier Abnova™ Supplier No. H00003604Q01S

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq]

Sequence: DCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Specifications

Accession Number AAH06196
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3604
Molecular Weight (g/mol) 36.63kDa
Name TNFRSF9 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 ug
Immunogen DCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias 4-1BB/CD137/CDw137/ILA/MGC2172
Common Name TNFRSF9
Gene Symbol TNFRSF9
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.