Abnova™ Human TRIM26 Partial ORF (NP_003440.1, 146 a.a. - 240 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-671	25 μg
89-965-670	10 μg

Catalog No. 89-965-671 Supplier Abnova™ Supplier No. H00007726Q02L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq]

Sequence: REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS

Specifications

• Accession Number: NP_003440.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7726
• Molecular Weight (g/mol): 36.19kDa
• Name: TRIM26 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: AFP/RNF95/ZNF173
• Common Name: TRIM26
• Gene Symbol: TRIM26
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid