Abnova™ Human TRPA1 Partial ORF (NP_015628, 1033 a.a. - 1117 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-843	25 μg
89-965-842	10 μg

Catalog No. 89-965-843 Supplier Abnova™ Supplier No. H00008989Q01L

Description

Used for AP, Array, ELISA, WB-Re

The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq]

Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL

Specifications

• Accession Number: NP_015628
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 8989
• Molecular Weight (g/mol): 35.09kDa
• Name: TRPA1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ANKTM1
• Common Name: TRPA1
• Gene Symbol: TRPA1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid