Abnova™ Human TRPC6 Partial ORF (NP_004612, 543 a.a. - 592 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-858	10 ug
89-965-859	25 ug

Catalog No. 89-965-858 Supplier Abnova™ Supplier No. H00007225Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq]

Sequence: ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ

Specifications

• Accession Number: NP_004612
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7225
• Molecular Weight (g/mol): 31.24kDa
• Name: TRPC6 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ11098/FLJ14863/FSGS2/TRP6
• Common Name: TRPC6
• Gene Symbol: TRPC6
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid