Abnova™ Human TSEN2 Partial ORF (NP_079541, 366 a.a. - 465 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-914	10 μg
89-965-915	25 μg

Catalog No. 89-965-914 Supplier Abnova™ Supplier No. H00080746Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: LLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL

Specifications

• Accession Number: NP_079541
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 80746
• Molecular Weight (g/mol): 36.74kDa
• Name: TSEN2 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: LLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC2776/MGC4440/PCH2B/SEN2/SEN2L
• Common Name: TSEN2
• Gene Symbol: TSEN2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid