Abnova™ Human TSG101 Partial ORF (AAH02487, 291 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-933	2 μg

Catalog No. 89-965-933 Supplier Abnova™ Supplier No. H00007251Q02

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression. [provided by RefSeq]

Sequence: LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTILYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Specifications

• Accession Number: AAH02487
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7251
• Molecular Weight (g/mol): 36.74kDa
• Name: TSG101 (Human) Recombinant Protein (Q02)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 2 μg
• Immunogen: LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTILYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: TSG10/VPS23
• Common Name: TSG101
• Gene Symbol: TSG101
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid