Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human TSTD1 (NP_001106678, 1 a.a. - 115 a.a.) Full-length Recombinant Protein with His tag

Catalog No. 89966038 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-966-038 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-966-038 Supplier Abnova™ Supplier No. P3424
Add to Cart
Add to Cart

Used for SDS-PAGE

Sequence: MGSSHHHHHHSSGLVPRGSHMAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES

Specifications

Accession Number NP_001106678
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 100131187
Molecular Weight (g/mol) 14.6kDa
Name TSTD1 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing Loading 3 ug protein in 15% SDS-PAGE
Quantity 50 μg
Immunogen MGSSHHHHHHSSGLVPRGSHMAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES
Storage Requirements Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias LOC100131187
Common Name RP11-544M22.4
Gene Symbol RP11-544M22.4
Species E. coli
Recombinant Recombinant
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.