Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106005

Invitrogen™ Human TXNL4A (aa 1-71) Control Fragment Recombinant Protein

Catalog No. RP106005
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106005 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106005 Supplier Invitrogen™ Supplier No. RP106005
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65294 (PA5-65294. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Essential role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes that are involved in spliceosome assembly.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P83876
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10907
Name Human TXNL4A (aa 1-71) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BMKS; D18Wsu98e; DIB1; Dim1; DIM1 protein homolog; ENSMUSG00000057130; SNRNP15; spliceosomal U5 snRNP-specific 15 kDa protein; thioredoxin like 4 A; thioredoxin-like 4; thioredoxin-like 4 A; thioredoxin-like protein 4 A; Thioredoxin-like U5 snRNP protein U5-15 kD; TXNL4; Txnl4a; U5-15 kD; U5-15 kDa
Common Name TXNL4A
Gene Symbol TXNL4A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.