Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human U2AF1L2 Partial ORF (NP_005080.1, 294 a.a. - 393 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human U2AF1L2 Partial ORF (NP_005080.1, 294 a.a. - 393 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89966313 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-966-313 25 μg
89-966-312 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-966-313 Supplier Abnova™ Supplier No. H00008233Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes an essential splicing factor. The encoded protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceosome assembly. [provided by RefSeq]

Sequence: GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG

Specifications

Accession Number NP_005080.1
For Use With (Application) Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 8233
Molecular Weight (g/mol) 36.74kDa
Name Human U2AF1L2 Partial ORF (NP_005080.1, 294 a.a. - 393 a.a.) Recombinant Protein with GST-tag at N-terminal
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Storage Requirements Store at −80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias MGC142014, MGC142040, U2AF1-RS2, U2AF1L2, U2AF1RS2, URP
Common Name U2AF1L2
Gene Symbol ZRSR2
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST Tag
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.