Abnova™ Human UCHL1 Partial ORF (NP_004172, 101 a.a. - 190 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-966-494	25 ug
89-966-493	10 ug

Catalog No. 89-966-494 Supplier Abnova™ Supplier No. H00007345Q02L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease

Sequence: NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSE

Specifications

• Accession Number: NP_004172
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7345
• Molecular Weight (g/mol): 35.64kDa
• Name: UCHL1 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: PARK5/PGP9.5/Uch-L1
• Common Name: UCHL1
• Gene Symbol: UCHL1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid