Learn More
Abnova™ Human VAV1 Partial ORF (AAH13361, 681 a.a. - 790 a.a.) Recombinant Protein with GST-tag at N-terminal
Shop All Abnova Corporation ProductsDescription
The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. [provided by RefSeq]
Specifications
Specifications
| Accession Number | AAH13361 |
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 7409 |
| Molecular Weight (g/mol) | 37.84kDa |
| Name | VAV1 (Human) Recombinant Protein (Q01) |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantity | 10 μg |
| Immunogen | RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.