Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP110003

Invitrogen™ Human VGLUT3 (aa 4-71) Control Fragment Recombinant Protein

Catalog No. RP110003
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP110003 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP110003 Supplier Invitrogen™ Supplier No. RP110003
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144781 (PA5-144781. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucose is fundamental to the metabolism of mammalian cells. Several glucose transporter protein (Glut) isoforms have been identified and shown to function in response to insulin and IGF-1 induced signaling. GLUT-3 is detectable in a few normal cell type spermatids in testis with active spermatogenesis, placental trophoblast membranes, and neurons in brain. GLUT-3 staining is also detectable in human cancers including those of the ovary, lung, and testis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NDX2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 246213
Name Human VGLUT3 (aa 4-71) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC042593; DFNA25; SLC17A8; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8; solute carrier family 17 (vesicular glutamate transporter), member 8; solute carrier family 17 member 8; Vesicular glutamate transporter 3; vesicular glutamate transporter-3; VGLUT 3; VGLUT3
Common Name VGLUT3
Gene Symbol SLC17A8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRPSPPLCDCHCCG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.