Abnova™ Human VIPR1 Partial ORF (NP_004615, 393 a.a. - 457 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-967-054	25 μg
89-967-053	10 μg

Catalog No. 89-967-054 Supplier Abnova™ Supplier No. H00007433Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. [provided by RefSeq]

Sequence: GEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV

Specifications

• Accession Number: NP_004615
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7433
• Molecular Weight (g/mol): 32.89kDa
• Name: VIPR1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: GEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ41949/HVR1/II/PACAP-R-2/RDC1/VAPC1/VIPR/VIRG/VPAC1/VPCAP1R
• Common Name: VIPR1
• Gene Symbol: VIPR1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid