Abnova™ Human VPS52 Partial ORF (NP_542131, 625 a.a. - 723 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-967-150	10 ug
89-967-151	25 ug

Catalog No. 89-967-150 Supplier Abnova™ Supplier No. H00006293Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18. [provided by RefSeq]

Sequence: RGQAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF

Specifications

• Accession Number: NP_542131
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6293
• Molecular Weight (g/mol): 36.63kDa
• Name: VPS52 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: RGQAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ARE1/DKFZp547I194/RP5-1033B10/SAC2/SACM2L/dJ1033B10.5
• Common Name: VPS52
• Gene Symbol: VPS52
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid