Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89967503

Abnova™ Human XAGE1C (NP_001091061, 1 a.a. - 81 a.a.) Full-length Recombinant Protein with His tag

Catalog No. 89967503 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-967-503 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-967-503 Supplier Abnova™ Supplier No. P5873
Add to Cart
Add to Cart

Description

Used for SDS-PAGE

XAGE1C is 1 of 5 copies of the XAGE1 gene (see XAGE1D; MIM 300289) (Chen et al., 2006 [PubMed 16382448]).[supplied by OMIM]

Sequence: MGSSHHHHHHSSGLVPRGSHMGSMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV

Specifications

For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 653048
Molecular Weight (g/mol) 11.5kDa
Name XAGE1C (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Quality Control Testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Quantity 10 μg
Immunogen MGSSHHHHHHSSGLVPRGSHMGSMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV
Storage Requirements Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name XAGE1C
Gene Symbol XAGE1C
Species E. coli
Recombinant Recombinant
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >85% by SDS - PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.