Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89967633

Abnova™ Human YWHAH (NP_003396, 1 a.a. - 246 a.a.) Full-length Recombinant Protein with His tag

Catalog No. 89967633 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-967-633 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-967-633 Supplier Abnova™ Supplier No. P3524
Add to Cart
Add to Cart

Description

Used for SDS-PAGE

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Specifications

Accession Number NP_003396
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 7533
Molecular Weight (g/mol) 30.3kDa
Name YWHAH (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing Loading 3 ug protein in 15% SDS-PAGE
Quantity 100 μg
Immunogen MGSSHHHHHHSSGLVPRGSHMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Storage Requirements Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias YWHA1
Common Name YWHAH
Gene Symbol YWHAH
Species E. coli
Recombinant Recombinant
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.