Abnova™ Human ZIC4 Partial ORF (NP_115529, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-967-912	10 μg
89-967-913	25 μg

Catalog No. 89-967-912 Supplier Abnova™ Supplier No. H00084107Q02S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. [provided by RefSeq]

Sequence: MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA

Specifications

• Accession Number: NP_115529
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 84107
• Molecular Weight (g/mol): 35.64kDa
• Name: ZIC4 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Quantity: 10 μg
• Immunogen: MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ42609/FLJ45833
• Common Name: ZIC4
• Gene Symbol: ZIC4
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid