Invitrogen™ IBA1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595409

Catalog No. PIPA595409

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

AIF1 is induced by cytokines and interferon. It is thought to be involved in the negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma.

Specifications

• Antigen: IBA1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: AIF1
• Gene Alias: AI607846; AIF1; AIF-1; Allograft inflammatory factor 1; balloon angioplasty responsive transcript; balloon angioplasty-responsive transcript 1; Bart1; BART-1; D17H6S50E; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; G1; Iba; Iba1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; IRT1; IRT-1; microglia response factor; Mrf1; MRF-1; protein BART-1; protein G1; testis specific
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 199
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P55008
• Gene Symbols: AIF1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG