Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579448

Invitrogen™ IGFBP-1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579448
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579448 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579448 Supplier Invitrogen™ Supplier No. PA579448
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Kidney Tissue, Mouse Kidney Tissue.

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
TRUSTED_SUSTAINABILITY

Specifications

Antigen IGFBP-1
Applications ELISA, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene IGFBP1
Gene Accession No. P21743, P47876
Gene Alias AFBP; alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; Binding protein 25; Binding protein 26; Binding protein 28; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; hIGFBP 1; hIGFBP1; hIGFBP-1; IBP 1; IBP1; IBP-1; IGF BP25; IGFBA; IGF-binding protein 1; IGFBP; IGFBP 1; Igfbp1; Igfbp-1; IGF-BP25; Insulin like growth factor binding protein; insulin like growth factor binding protein 1; insulin-like growth factor binding protein 1; INSULIN-LIKE GROWTH FACTOR BINDING PROTEIN 1 PRECURSOR (IGFBP-1) (IBP-1) (IGF-BINDING PROTEIN 1); insulin-like growth factor-binding protein 1; Placental protein 12; PP 12; PP12
Gene Symbols IGFBP1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP-1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16006, 25685
Target Species Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.