Invitrogen™ IL17RE Monoclonal Antibody (46N7E3)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA524806

Catalog No. PIMA524806

Description

Immunogen amino acids (97-199) contain the sequence MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE.

The interleukin 17 receptor E (IL-17RE) shares limited similarity to the receptor of IL-17A, a ubiquitous type I membrane glycoprotein that with IL-17A plays a pathogenic role in many inflammatory and autoimmune diseases such as rheumatoid arthritis. IL-17RE is the functional receptor of IL-17C and has been suggested to mediate mucosal immunity to infection with intestinal pathogens. IL-17C is produced by epithelia in response to bacterial challenge and binds to a receptor complex formed by IL-17RE and IL-17RA on the epithelial cell surface, thereby regulating the immune function of epithelial cells in an autocrine manner.

Specifications

• Antigen: IL17RE
• Classification: Monoclonal
• Concentration: 0.5 mg/mL
• Formulation: PBS with 0.05% BSA and 0.05% sodium azide
• Gene Accession No.: Q8NFR9
• Gene Symbols: IL17RE
• Immunogen: Recombinant human IL17E which corresponds to Amino acids (97-199).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Clone: 46N7E3
• Conjugate: Unconjugated
• Gene: IL17RE
• Gene Alias: AA589509; IL-17 receptor E; IL17RE; IL-17RE; Il25r; interleukin 17 receptor E; interleukin-17 receptor E; UNQ3056/PRO9877
• Host Species: Mouse
• Purification Method: Protein G
• Regulatory Status: RUO
• Gene ID (Entrez): 132014
• Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
• Form: Liquid