Abnova™ IL6 Recombinant Protein

Catalog No.	Quantity
89-014-033	10 μg

Catalog No. 89-014-033 Supplier Abnova™ Supplier No. H00003569P0110

Description

Human IL6 full-length ORF recombinant protein with GST-tag at N-terminal

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, α. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.

• Theoretical MW (kDa): 48.95
• Preparation method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH15511.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Gene ID (Entrez): 3569
• Molecular Weight (g/mol): 49.32
• Name: IL6 (Human) Recombinant Protein (P01)
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Source: Wheat Germ (in vitro)
• Immunogen: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: BSF2/HGF/HSF/IFNB2/IL-6
• Common Name: IL6
• Gene Symbol: IL6
• Cross Reactivity: Human
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Form: Solution