Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579516

Invitrogen™ IRF2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579516
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579516 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579516 Supplier Invitrogen™ Supplier No. PA579516
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Intestine Tissue, SW620 whole cell, COLO320 whole cell, HELA whole cell, A549 whole cell.

IRF2 belongs to the interferon regulatory factor family. IRF2 regulates the transcription regulation important to cell proliferation as well as immune responses by binding to the upstream regulatory region of type I IFN and IFNinducible MHC class I genes (the interferon consensus sequence (ICS)) and repression of those genes. However, IRF2 also functions as a transcriptional activator of histone H4 by interactions with NF-kappa B.
TRUSTED_SUSTAINABILITY

Specifications

Antigen IRF2
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene IRF2
Gene Accession No. P14316
Gene Alias 9830146E22Rik; AI646973; DKFZp686F0244; Interferon regulatory factor 2; IRF2; Irf-2; OTTHUMP00000218576; OTTHUMP00000218580
Gene Symbols IRF2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 290749, 3660
Target Species Human, Rat, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.