Learn More
CPC Scientific H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2 (trifluoroacetate salt) 1MG

Supplier: CPC Scientific LL37003A
LL-37 amide is an antimicrobial peptide with angiogenic activity.ONE-LETTER SEQUENCE: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2MOLECULAR FORMULA: C205H341N61O52MOLECULAR WEIGHT:4492.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [597562-32-8], RESEARCH AREA: AntimicrobialREFERENCES: S.Sandgren et al., J. Biol. Chem., 279, 17951 (2004); F.Neville et al., Biophys. J., 90, 1275 (2006); U.H.Dürr et al., Biochim. Biophys. Acta, 1758, 1408 (2006); T.Tecle et al., Innate Immun., 16, 151 (2010)
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.