Learn More
CPC Scientific H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2 (trifluoroacetate salt) 1MG

Supplier: CPC Scientific LL37003A

LL-37 amide is an antimicrobial peptide with angiogenic activity.ONE-LETTER SEQUENCE: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2MOLECULAR FORMULA: C205H341N61O52MOLECULAR WEIGHT:4492.34STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [597562-32-8], RESEARCH AREA: AntimicrobialREFERENCES: S.Sandgren et al., J. Biol. Chem., 279, 17951 (2004); F.Neville et al., Biophys. J., 90, 1275 (2006); U.H.Dürr et al., Biochim. Biophys. Acta, 1758, 1408 (2006); T.Tecle et al., Innate Immun., 16, 151 (2010)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.