Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Lyn Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595460
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595460 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595460 Supplier Invitrogen™ Supplier No. PA595460
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell. IHC: mouse intestine tissue, rat spleen tissue, human tonsil tissue, mouse spleen tissue, rat lymphaden tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).
TRUSTED_SUSTAINABILITY

Specifications

Antigen Lyn
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene LYN
Gene Accession No. P07948, P25911, Q07014
Gene Alias AA407514; CD180; CD180 antigen; CD180 molecule; CH73-38P6.3; FLJ26625; Hck-2; JTK8; lck/Yes-related novel protein tyrosine kinase; LY64; Ly78; lymphocyte antigen 64; lymphocyte antigen-64, radioprotective, 105kDa; LYN; lyn protein non-receptor kinase; lyn protein tyrosine kinase; LYN proto-oncogene, Src family tyrosine kinase; p53Lyn; p56Lyn; Radioprotective 105 kDa protein; RP105; Tyrosine-protein kinase Lyn; v-yes-1 Yamaguchi sarcoma viral related oncogene homolog; v-yes-1 Yamaguchi sarcoma viral related oncogene protein-like protein; Yamaguchi sarcoma viral (v-yes-1) oncogene homolog; zgc:92124
Gene Symbols LYN
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17096, 4067, 81515
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.