Novus Biologicals™ MARCH6 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MARCH6. Source: E.coli Amino Acid Sequence: HTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLN The MARCH6 Recombinant Protein Antigen is derived from E. coli. The MARCH6 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 10299
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: MARCH6 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: E3 ubiquitin-protein ligase MARCH6, EC 6.3.2.-, MARCH-VIDOA10, membrane-associated ring finger (C3HC4) 6, Membrane-associated RING finger protein 6, Membrane-associated RING-CH protein VI, Protein TEB-4, RNF176KIAA0597Doa10 homolog, TEB4RING finger protei
• Gene Symbol: MARCHF6
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51373. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.