Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ MBP Monoclonal Antibody (7D2)

Catalog No. PIMA547369
Change view
Click to view available options
Quantity:
100 μL
500 μL
Catalog No. Quantity
PIMA547369 500 μL
PIMA547468 100 μL
2 options

Catalog No. PIMA547369

Supplier: Invitrogen™ MA547369

Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

MBP Monoclonal Antibody for ICC/IF, IHC, Western Blot

The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MBP
Applications Immunohistochemistry, Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 7D2
Concentration 1 mg/mL
Conjugate Unconjugated
Formulation PBS with 50% glycerol and 5mM sodium azide
Gene MBP
Gene Accession No. P02686, P02687, P02688, P04370, P81558, P83487
Gene Alias 20 kDa microtubule-stabilizing protein; C76307; golli mbp; Golli-mbp; Golli-MBP; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; Hmbpr; MBP; MBP S; Mbps; MGC99675; microtubule-stabilizing protein; mld; MOBP; Myelin A1 protein; myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; myelin membrane encephalitogenic protein; Myelin P1 protein; myelin-associated oligodendrocyte basic protein; R75289; shi; shiverer; Unknown (protein for IMAGE:7984318); unnamed protein product
Gene Symbols MBP
Host Species Mouse
Immunogen Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
Purification Method Protein G
Quantity 500 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 100063306, 17196, 24547, 414286, 4155, 618684
Target Species Bovine, Horse, Human, Mouse, Pig, Rat
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Product Type Antibody
Form Liquid
Isotype IgG1
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.