Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ MBP Monoclonal Antibody (7D2)
Mouse Monoclonal Antibody
Supplier: Invitrogen™ MA547369
Description
MBP Monoclonal Antibody for Western Blot, ICC/IF, IHC
The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called Golli-MBP) that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
Specifications
MBP | |
Monoclonal | |
1 mg/mL | |
PBS with 50% glycerol and 5mM sodium azide | |
P02686, P02687, P02688, P04370, P81558, P83487 | |
MBP | |
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. | |
500 μL | |
Primary | |
Human, Mouse, Rat, Bovine, Pig, Horse | |
Antibody | |
IgG1 |
Immunohistochemistry, Western Blot, Immunocytochemistry | |
7D2 | |
Unconjugated | |
MBP | |
20 kDa microtubule-stabilizing protein; C76307; golli mbp; Golli-mbp; Golli-MBP; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; Hmbpr; MBP; MBP S; Mbps; MGC99675; microtubule-stabilizing protein; mld; MOBP; Myelin A1 protein; myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; myelin membrane encephalitogenic protein; Myelin P1 protein; myelin-associated oligodendrocyte basic protein; R75289; shi; shiverer; Unknown (protein for IMAGE:7984318); unnamed protein product | |
Mouse | |
Protein A/G | |
RUO | |
100063306, 17196, 24547, 414286, 4155, 618684 | |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. | |
Liquid |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction