Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP257785PE

Novus Biologicals™ MED26 Recombinant Protein Antigen
SDP

Catalog No. NBP257785PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257785PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP257785PE Supplier Novus Biologicals™ Supplier No. NBP257785PEP
Only null left
Add to Cart
Add to Cart

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED26. Source: E.coli Amino Acid Sequence: ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS The MED26 Recombinant Protein Antigen is derived from E. coli. The MED26 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 9441
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name MED26 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa,
Gene Symbol MED26
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53314. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For research use only.

Product Title
missing translation for 'pleaseSelectIssue'

missing translation for 'byClickingSubmit' missing translation for 'privacyPolicy'.