Invitrogen™ MEF2C Polyclonal Antibody

Catalog No.	Quantity
PIPA595568	100 μg

Catalog No. PIPA595568 Supplier Invitrogen™ Supplier No. PA595568

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human K562 whole cell, human COLO320 whole cell, human DAUDI whole cell, human U937 whole cell, rat brain tissue. IHC: human tonsil tissue, rat brain tissue, mouse brain tissue. Flow: HELA cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

MEF2C is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.

Specifications

• Antigen: MEF2C
• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: MEF2C
• Gene Accession No.: Q06413, Q8CFN5
• Gene Alias: 5430401D19Rik; 9930028G15Rik; AV011172; C5DELq14.3; DEL5q14.3; hoo; hoover; id:ibd5026; MADS box transcription enhancer factor 2, polypeptide C; Mef2; mef2c; mef2c protein; mef2ca; Myocyte enhancer factor 2C; myocyte enhancer factor 2C MEF2C; myocyte enhancer factor 2ca; myocyte enhancer factor 2ca 4'-6'; myocyte enhancer factor 2ca delta gamma-like; myocyte enhancer factor 2ca variant 4; myocyte enhancer factor 2ca variant 5; myocyte enhancer factor 2ca variant 6; myocyte enhancer factor 2ca; myocyte-specific enhancer factor 2C; myocyte-specific enhancer factor 2C; RGD1563119; wu:fc05b06; zgc:64184; zgc:85726
• Gene Symbols: MEF2C
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 17260, 4208, 499497
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov