Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ MEF2C Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595568
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595568 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595568 Supplier Invitrogen™ Supplier No. PA595568
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human K562 whole cell, human COLO320 whole cell, human DAUDI whole cell, human U937 whole cell, rat brain tissue. IHC: human tonsil tissue, rat brain tissue, mouse brain tissue. Flow: HELA cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

MEF2C is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MEF2C
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene MEF2C
Gene Accession No. Q06413, Q8CFN5
Gene Alias 5430401D19Rik; 9930028G15Rik; AV011172; C5DELq14.3; DEL5q14.3; hoo; hoover; id:ibd5026; MADS box transcription enhancer factor 2, polypeptide C; Mef2; mef2c; mef2c protein; mef2ca; Myocyte enhancer factor 2C; myocyte enhancer factor 2C MEF2C; myocyte enhancer factor 2ca; myocyte enhancer factor 2ca 4'-6'; myocyte enhancer factor 2ca delta gamma-like; myocyte enhancer factor 2ca variant 4; myocyte enhancer factor 2ca variant 5; myocyte enhancer factor 2ca variant 6; myocyte enhancer factor 2ca; myocyte-specific enhancer factor 2C; myocyte-specific enhancer factor 2C; RGD1563119; wu:fc05b06; zgc:64184; zgc:85726
Gene Symbols MEF2C
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17260, 4208, 499497
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.