Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Methionine Sulfoxide Reductase B Recombinant Protein Antigen
SDP

Catalog No. NBP257316PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257316PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP257316PE Supplier Novus Biologicals™ Supplier No. NBP257316PEP
Only null left
Add to Cart
Add to Cart

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Methionine Sulfoxide Reductase B. Source: E.coli Amino Acid Sequence: PGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVRGHRGGGGTGAARESREPVPPSSLCLPHSSRGLEASIPGLLPLPGSCH The Methionine Sulfoxide Reductase B Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 51734
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name Methionine Sulfoxide Reductase B Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias EC 1.8.4.-, methionine sulfoxide reductase, methionine-R-sulfoxide reductase B1, MGC3344, MsrB1, MSRB1selenoprotein R, Selenoprotein X, selenoprotein X, 1, SELR, SelX
Gene Symbol MSRB1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53162. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.