Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579675

Invitrogen™ MLH1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579675
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579675 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579675 Supplier Invitrogen™ Supplier No. PA579675
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human Hela whole cell, human COLO-320 whole cell, human T-47D whole cell, human A549 whole cell.

MLH1 is a DNA mismatch repair protein. The repair of mismatch DNA is essential to maintaining the integrity of genetic information over time. An alteration of microsatellite repeats is the result of slippage owing to strand misalignment during DNA replication and is referred to as microsatellite instability (MSI). These defects in DNA repair pathways have been related to human carcinogenesis. The importance of mismatch repair genes became apparent with the identification of the genetic basis for hereditary nonpolyposis colon cancer (HNPC). MSHS2 is involved in the initial cognition of mismatch nucleotides during the replication mismatch repair process. It is thought that after MSH2 binds to a mismatched DNA duplex it is joined by a heterodimer of MLH1 and PMSH, which together help facilitate the later steps in mismatch repair.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MLH1
Applications ChIP Assay, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Mlh1
Gene Accession No. P40692
Gene Alias 1110035C23Rik; AI317206; AI325952; AI561766; COCA2; colon cancer, nonpolyposis type 2; DNA mismatch repair protein Mlh1; DNA mismatch repair protein Mlh1-like protein; FCC2; hMLH1; HNPCC; HNPCC2; I79_014127; MGC5172; mismatch repair protein 1; MLH1; MLH-1; mutL homolog 1; mutL homolog 1 (E. coli); mutL homolog 1, colon cancer, nonpolyposis type 2; mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli); mutL protein homolog 1
Gene Symbols Mlh1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4292
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.