Invitrogen™ MLH1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579675

Catalog No. PIPA579675

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human Hela whole cell, human COLO-320 whole cell, human T-47D whole cell, human A549 whole cell.

MLH1 is a DNA mismatch repair protein. The repair of mismatch DNA is essential to maintaining the integrity of genetic information over time. An alteration of microsatellite repeats is the result of slippage owing to strand misalignment during DNA replication and is referred to as microsatellite instability (MSI). These defects in DNA repair pathways have been related to human carcinogenesis. The importance of mismatch repair genes became apparent with the identification of the genetic basis for hereditary nonpolyposis colon cancer (HNPC). MSHS2 is involved in the initial cognition of mismatch nucleotides during the replication mismatch repair process. It is thought that after MSH2 binds to a mismatched DNA duplex it is joined by a heterodimer of MLH1 and PMSH, which together help facilitate the later steps in mismatch repair.

Specifications

• Antigen: MLH1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Mlh1
• Gene Alias: 1110035C23Rik; AI317206; AI325952; AI561766; COCA2; colon cancer, nonpolyposis type 2; DNA mismatch repair protein Mlh1; DNA mismatch repair protein Mlh1-like protein; FCC2; hMLH1; HNPCC; HNPCC2; I79_014127; MGC5172; mismatch repair protein 1; MLH1; MLH-1; mutL homolog 1; mutL homolog 1 (E. coli); mutL homolog 1, colon cancer, nonpolyposis type 2; mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli); mutL protein homolog 1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 4292
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: ChIP Assay, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P40692
• Gene Symbols: Mlh1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov