Invitrogen™ MMP9 Polyclonal Antibody

Catalog No.	Quantity
PIPA579689	100 μg

Catalog No. PIPA579689 Supplier Invitrogen™ Supplier No. PA579689

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: NRK whole cell, ANA-1 whole cell, HEPA whole cell. IHC: mouse kidney tissue, rat liver tissue.

MMP9 (matrix metallopeptidase 9, GELB, CLG4B) is a matrix metalloproteinase, a family of zinc and calcium-dependent endopeptidases that degrade extracellular matrix proteins. MMP9 is secreted as a 92kDa zymogen and cleavage of pro-MMP9 results in the active enzyme with a molecular weight of 82kDa. MMP9 has a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells, and is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 is supplied by bone marrow-derived cells and contributes to skin carcinogenesis. Further, MMP9 degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. Studies have shown that elevated MMP9 is associated with progression of idiopathic atrial fibrillation and aortic aneurysm.

Specifications

• Antigen: MMP9
• Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: MMP9
• Gene Accession No.: P41245, P50282
• Gene Alias: 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; 92kD gelatinase; 92kD type IV collagenase; 92kDa gelatinase; 92kDa type IV collagenase; 92-kDa type IV collagenase; AW743869; B/MMP9; Clg4b; collagenase type IVB; fj05a08; Gel B; gelatinase B; Gelatinase-B; GELB; macrophage gelatinase; MANDP2; matrix metallo protease; matrix metallopeptidase 9; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9; matrix metalloproteinase 9 (gelatinase B 92-kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92kDa matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase); Matrix metalloproteinase9; matrix metalloproteinase-9; MMP; Mmp9; MMP-9; mmp9 protein; MMP-9 protein; MMPs; Preproform of 92-kDa type IV collagenase (MMP-9): N-terminal; pro-MMP-9; type IV collagenase; type V collagenase; wu:fb02g06; wu:fb07b05; wu:fi98c09; wu:fj05a08; ZFMMP-9; zgc:64165
• Gene Symbols: MMP9
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 17395, 81687
• Target Species: Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov