Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595602

Invitrogen™ MOG Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595602 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595602 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595602 Supplier Invitrogen™ Supplier No. PA595602
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. IHC: human glioma tissue, mouse brain tissue, rat brain tissue, rat brain tissue. Flow: U251 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MOG
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene MOG
Gene Accession No. Q16653, Q61885, Q63345
Gene Alias B230317G11Rik; BTN6; BTNL11; DAQB-92E24.2; dystonia 2, torsion (autosomal recessive); MGC26137; MOG; MOG alpha 6; MOG alpha-5; MOG alpha-6; MOG AluA; MOG AluB; MOG Ig AluB; MOG Ig-AluB; MOGIG2; MOGIG-2; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; NRCLP7
Gene Symbols MOG
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17441, 24558, 4340
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.