Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA5143951

Invitrogen™ MORC3 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA5143951
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA5143951 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA5143951 Supplier Invitrogen™ Supplier No. PA5143951
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: rat heart tissue, rat liver tissue, mouse heart tissue. IHC: human mammary cancer tissue, human rectal cancer tissue. ICC/IF: A431 cell. Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled coil domain.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MORC3
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene MORC3
Gene Accession No. F7BJB9, Q14149
Gene Alias 1110051N18Rik; AI452146; BF318192; D16Jhu32e; KIAA0136; microrchidia 3; MORC family CW-type zinc finger 3; MORC family CW-type zinc finger protein 3; Morc3; Nuclear matrix protein 2; nuclear matrix protein NXP2; NXP2; ZCW5; Zcwcc3; Zinc finger CW-type coiled-coil domain protein 3; zinc finger, CW type with coiled-coil domain 3; zinc finger, CW-type with coiled-coil domain 3
Gene Symbols MORC3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human MORC3 (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23515, 304074, 338467
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.