ADAM12, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-805	50 μL

Catalog No. 89-105-805 Supplier Abnova Corporation Supplier No. H00008038A01

Description

Mouse polyclonal antibody raised against a partial recombinant ADAM12.

This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene has two alternatively spliced transcripts: a shorter secreted form and a longer membrane-bound form. The shorter form is found to stimulate myogenesis. [provided by RefSeq

Sequence: ETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQ

Specifications

• Antigen: ADAM12
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ADAM12.
• Formulation: 50% glycerol
• Gene: ADAM12
• Gene Accession No.: NM_003474
• Gene Alias: MCMP/MCMPMltna/MLTN/MLTNA
• Gene Symbols: ADAM12
• Host Species: Mouse
• Immunogen: ADAM12 (NP_003465, 208 a.a. to 304 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8038
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only