ADCY2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ADCY2.

Supplier:  Abnova Corporation H00000108A01

Catalog No. 89-104-042

Description

This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq]

Sequence: GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS

Specifications

• Antigen: ADCY2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ADCY2.
• Gene: ADCY2
• Gene Alias: AC2/FLJ16822/FLJ45092/HBAC2/KIAA1060/MGC133314
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_020546
• Gene Symbols: ADCY2
• Immunogen: ADCY2 (NP_065433, 977 a.a. to 1086 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 108
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only