COL11A2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-307	50 μL

Catalog No. 89-104-307 Supplier Abnova Corporation Supplier No. H00001302A01

Description

Mouse polyclonal antibody raised against a partial recombinant COL11A2.

This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. It is located on chromosome 6 very close to but separate from the gene for retinoid X receptor beta. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Proteolytic processing of this type XI chain produces PARP, a proline/arginine-rich protein that is an amino terminal domain. Mutations in this gene are associated with type III Stickler syndrome, otospondylomegaepiphyseal dysplasia (OSMED syndrome), Weissenbacher-Zweymuller syndrome, autosomal dominant nonsyndromic sensorineural type 13 deafness (DFNA13), and autosomal recessive nonsyndromic sensorineural type 53 deafness (DFNB53). Alternative splicing results in multiple transcript variants. A related pseudogene is located nearby on chromosome 6. [provided by RefSeq

Sequence: APPVDVLRALRFPSLPDGVRRAKGICPADVAYRVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPVRFLYEDQT

Specifications

• Antigen: COL11A2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant COL11A2.
• Formulation: 50% glycerol
• Gene: COL11A2
• Gene Accession No.: NM_080680
• Gene Alias: DFNA13/DFNB53/HKE5/PARP/STL3
• Gene Symbols: COL11A2
• Host Species: Mouse
• Immunogen: COL11A2 (NP_542411, 29 a.a. to 128 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1302
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only