DFNB31, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DFNB31.

Supplier:  Abnova Corporation H00025861A01

Catalog No. 89-106-665

Description

In rat brain, Cip98 interacts with a calmodulin-dependent serine kinase, CASK (MIM 300172), and may be involved in the formation of scaffolding protein complexes that facilitate synaptic transmission in the central nervous system (CNS) (Yap et al., 2003 [PubMed 12641734]). Mutations in this gene, also known as WHRN, cause DFNB31 (MIM 607084).[supplied by OMIM

Sequence: GLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML

Specifications

• Antigen: DFNB31
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant DFNB31.
• Gene: DFNB31
• Gene Alias: CIP98/DKFZp434N014/KIAA1526/RP11-9M16.1/USH2D/WHRN/WI
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_015404
• Gene Symbols: DFNB31
• Immunogen: DFNB31 (NP_056219, 808 a.a. to 907 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 25861
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only