GRID2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-582	50 μL

Catalog No. 89-104-582 Supplier Abnova Corporation Supplier No. H00002895A01

Description

Mouse polyclonal antibody raised against a partial recombinant GRID2.

Human glutamate receptor delta-2 (GRID2) is a relatively new member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. GRID2 is a predicted 1007 amino acid protein that shares 97% identity with the mouse homolog which is expressed selectively in cerebellar Purkinje cells. A point mutation in mouse GRID2, associated with the phenotype named 'lurcher', in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This strongly suggests a role for GRID2 in neuronal apoptotic death. [provided by RefSeq]

Sequence: DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI

Specifications

• Antigen: GRID2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GRID2.
• Formulation: 50% glycerol
• Gene: GRID2
• Gene Accession No.: NM_001510
• Gene Alias: MGC117022/MGC117023/MGC117024
• Gene Symbols: GRID2
• Host Species: Mouse
• Immunogen: GRID2 (NP_001501, 908 a.a. to 1007 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2895
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only