HIST1H4H, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-842	50 μL

Catalog No. 89-105-842 Supplier Abnova Corporation Supplier No. H00008365A01

Description

Mouse polyclonal antibody raised against a partial recombinant HIST1H4H.

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq

Sequence: TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Specifications

• Antigen: HIST1H4H
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HIST1H4H.
• Formulation: 50% glycerol
• Gene: HIST1H4H
• Gene Accession No.: NM_003543
• Gene Alias: H4/h/H4FH
• Gene Symbols: HIST1H4H
• Host Species: Mouse
• Immunogen: HIST1H4H (NP_003534, 31 a.a. ∽ 103 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8365
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only