HYAL4, Mouse, Clone: 1B10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HYAL4.

Supplier:  Abnova Corporation H00023553M03A

Catalog No. 89-106-621

Description

This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. [provided by RefSeq

Sequence: FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS

Specifications

• Antigen: HYAL4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_012269
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 1B10
• Description: Mouse monoclonal antibody raised against a partial recombinant HYAL4.
• Gene: HYAL4
• Gene Symbols: HYAL4
• Immunogen: HYAL4 (NP_036401.1,357 a.a. ∽ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 23553
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites