KLF12, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-500	50 μL

Catalog No. 89-106-500 Supplier Abnova Corporation Supplier No. H00011278A01

Description

Mouse polyclonal antibody raised against a partial recombinant KLF12.

Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR

Specifications

• Antigen: KLF12
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KLF12.
• Formulation: 50% glycerol
• Gene: KLF12
• Gene Accession No.: NM_007249
• Gene Alias: AP-2rep/AP2REP/HSPC122
• Gene Symbols: KLF12
• Host Species: Mouse
• Immunogen: KLF12 (NP_009180, 1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11278
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only