Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107085

LMO3, Mouse, Clone: 4A8, Abnova™

Catalog No. 89107085 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-085 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-085 Supplier Abnova Corporation Supplier No. H00055885M06A
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant LMO3.

Sequence: MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR

Specifications

Antigen LMO3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4A8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LMO3.
Formulation ascites with no preservative
Gene LMO3
Gene Accession No. NM_018640
Gene Alias DAT1/MGC26081/RBTN3/RBTNL2/RHOM3/Rhom-3
Gene Symbols LMO3
Host Species Mouse
Immunogen LMO3 (NP_061110,91 a.a. ∽ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55885
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.