MACF1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MACF1.

Supplier:  Abnova Corporation H00023499A01

Catalog No. 89-106-613

Description

The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF

Specifications

• Antigen: MACF1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MACF1.
• Gene: MACF1
• Gene Alias: ABP620/ACF7/FLJ45612/FLJ46776/KIAA0465/KIAA1251/MACF/OFC4
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC007330
• Gene Symbols: MACF1
• Immunogen: MACF1 (AAH07330, 1 a.a. ∽ 95 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 23499
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only