MAP2K3, Mouse, Clone: 2F12, Abnova™

Catalog No.	Quantity
89-105-214	200 μL

Catalog No. 89-105-214 Supplier Abnova Corporation Supplier No. H00005606M01A

Description

Mouse monoclonal antibody raised against a partial recombinant MAP2K3.

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq

Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVN

Specifications

• Antigen: MAP2K3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAP2K3.
• Formulation: ascites with no preservative
• Gene: MAP2K3
• Gene Accession No.: BC032478
• Gene Alias: MAPKK3/MEK3/MKK3/PRKMK3
• Gene Symbols: MAP2K3
• Host Species: Mouse
• Immunogen: MAP2K3 (AAH32478,1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5606
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ