MYL6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MYL6.

Supplier:  Abnova Corporation H00004637A01

Catalog No. 89-104-967

Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and nonmuscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEG

Specifications

• Antigen: MYL6
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MYL6.
• Gene: MYL6
• Gene Alias: ESMLC/LC17-GI/LC17-NM/LC17A/LC17B/MLC1SM/MLC3NM/MLC3SM
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_021019
• Gene Symbols: MYL6
• Immunogen: MYL6 (NP_066299, 1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 4637
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only