Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MYOG, Mouse, Clone: 2E19, Abnova™

Catalog No. 89104973 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-973 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-973 Supplier Abnova Corporation Supplier No. H00004656M05
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant MYOG.

Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. [provided by RefSeq

Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Specifications

Antigen MYOG
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E19
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant MYOG.
Formulation PBS with no preservative; pH 7.4
Gene MYOG
Gene Accession No. BC053899
Gene Alias MYF4/MYOGENIN/bHLHc3
Gene Symbols MYOG
Host Species Mouse
Immunogen MYOG (AAH53899,1 a.a. ∽ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4656
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.