Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NME7, Mouse, Clone: 1A11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NME7.

Supplier: Abnova Corporation H00029922M08A

Catalog No. 89-106-794

$683.34 / Each of 1

Qty

Add to Cart

Description

Sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL

Specifications

Antigen	NME7
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	ascites with no preservative
Gene Accession No.	NM_013330
Gene Symbols	NME7
Immunogen	NME7 (NP_004547,277 a.a. ∽ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	29922
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Ascites

Applications	ELISA
Clone	1A11
Description	Mouse monoclonal antibody raised against a partial recombinant NME7.
Gene	NME7
Gene Alias	FLJ37194/nm23-H7
Host Species	Mouse
Quantity	200 μL
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG1 κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

NME7, Mouse, Clone: 1A11, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions