RAPGEF2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-135	50 μL

Catalog No. 89-106-135

Supplier: Abnova Corporation H00009693A01

Description

Mouse polyclonal antibody raised against a partial recombinant RAPGEF2.

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM

Sequence: PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV

Specifications

• Antigen: RAPGEF2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant RAPGEF2.
• Formulation: 50% glycerol
• Gene: RAPGEF2
• Gene Accession No.: XM_376350
• Gene Alias: CNrasGEF/NRAPGEP/PDZ-GEF1/PDZGEF1/RA-GEF/Rap-GEP
• Gene Symbols: RAPGEF2
• Host Species: Mouse
• Immunogen: RAPGEF2 (XP_376350, 1398 a.a. ∽ 1487 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9693
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only