Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104922

SCGB2A1, Mouse, Clone: 2E2, Abnova™

Catalog No. 89104922 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-922 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-922 Supplier Abnova Corporation Supplier No. H00004246M07
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant SCGB2A1.

Sequence: MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

Specifications

Antigen SCGB2A1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant SCGB2A1.
Formulation PBS with no preservative; pH 7.4
Gene SCGB2A1
Gene Accession No. NM_002407.1
Gene Alias LPHC/MGB2/MGC71973/UGB3
Gene Symbols SCGB2A1
Host Species Mouse
Immunogen SCGB2A1 (NP_002398.1,1 a.a. ∽ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4246
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.